PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001188-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 386aa    MW: 44672.5 Da    PI: 9.879
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001188-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding476e-15453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vk++G++ W++++++mg    R +k+c +rw +yl
    NNU_001188-RA  4 RQRWQPEEDALLRAYVKKYGPKEWNLVSQRMGkpHDRDAKSCLERWKNYL 53
                     89********************************9*************97 PP

2Myb_DNA-binding33.31.2e-1059103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T eE+ l + + +++G++ Wk+Ia++++ gRt+k +  +w  +
    NNU_001188-RA  59 KGSLTLEEQNLVISLQAKYGNK-WKKIASEVP-GRTAKRLGKWWEVF 103
                      57789*****************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.364157IPR017930Myb domain
SMARTSM007171.4E-13355IPR001005SANT/Myb domain
PfamPF002491.0E-13453IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-22498IPR009057Homeodomain-like
CDDcd001675.85E-9653No hitNo description
Gene3DG3DSA:1.10.10.603.9E-20660IPR009057Homeodomain-like
SMARTSM007172.3E-958106IPR001005SANT/Myb domain
PROSITE profilePS5129417.3958108IPR017930Myb domain
PfamPF002494.2E-959100IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-1561106IPR009057Homeodomain-like
CDDcd001674.44E-663104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MKERQRWQPE EDALLRAYVK KYGPKEWNLV SQRMGKPHDR DAKSCLERWK NYLKPGIKKG  60
SLTLEEQNLV ISLQAKYGNK WKKIASEVPG RTAKRLGKWW EVFKAKQLKL QQQQQHQKTH  120
QQQRPLPSDY PDPSTASSIP PPTTTLHGQY DHILETFAEK YVQPKLLKLQ QRQPQPSLLP  180
PSLLMPSHLS LPEAPPPILS LSTTVLPAWM NTPNLVSSTP SLSSSSSTTP SPSVSHLHSP  240
QEPTCLDSVS QEMGLTHQRF FTLHEMGVLA QYCKEIEEGK KNLLQRKKEA TWRLNRLEQQ  300
LESEKARKMK EKMEEVEAKI RCLRNEEIAY LDKIENECEE QLKAIQIEEE AKEAKMVEAW  360
CSKQVKLAKL VKHMGIHRFH LTKNLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C7e-15792789C-Myb DNA-Binding Domain
1msf_C7e-15792789C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1285309RKKEATWRLNRLEQQLESEKARKMK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262975.10.0PREDICTED: protein rough sheath 2 homolog
TrEMBLA0A068U2N01e-153A0A068U2N0_COFCA; Uncharacterized protein
STRINGVIT_14s0083g00120.t011e-142(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-70MYB family protein